Cupriavidus necator NH9: BJN34_35870 Help Entry BJN34_35870       CDS       T05121                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism cuh  Cupriavidus necator NH9 Brite KEGG Orthology (KO) [BR:cuh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cuh03036]     BJN34_35870    03400 DNA repair and recombination proteins [BR:cuh03400]     BJN34_35870 Chromosome and associated proteins [BR:cuh03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BJN34_35870 DNA repair and recombination proteins [BR:cuh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BJN34_35870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Motif Other DBs NCBI-ProteinID:  AQV99256 UniProt:  A0A1U9V2S2 LinkDB All DBs Position pENH92:160934..161182 Genome browser AA seq 82 aa AA seqDB search MTANNERAEAIRWIRAQMADYGLTLEELEAAGCFDQPPPPSPPPPVCYRNAQGMSWDGQG EMPDWLRRAVNAGQSKEFYRVG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacagccaacaatgagcgggcggaagcgatccgctggatccgggcccagatggccgac tatgggctgacgctggaagagttggaggcggcggggtgcttcgaccaacctccgccccca tcccctccgccgccggtctgctaccgcaacgcccagggaatgagctgggacgggcagggc gagatgcccgattggctgcggcgggcggtcaatgcggggcagagtaaggagttctaccgg gtcggataa

DBGET integrated database retrieval system