KEGG   Cupriavidus necator NH9: BJN34_37380
Entry
BJN34_37380       CDS       T05121                                 
Symbol
cbnA
Name
(GenBank) chlorocatechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00361  Chlorocyclohexane and chlorobenzene degradation
cuh01100  Metabolic pathways
cuh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    BJN34_37380 (cbnA)
Enzymes [BR:cuh01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     BJN34_37380 (cbnA)
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg
Other DBs
NCBI-ProteinID: AQV99549
UniProt: Q9WXC8
LinkDB
Position
pENH91:52931..53686
AA seq 251 aa
MNERVKQVASALVDAIQKTLTEQRVTEEEWRAGVGYMMKLAEAKEMALLLDVFFNHTIVD
LKAQATRGSTPAIQGPYFLEGAPVVAGALKTYEDDSHHPLVIRGAVRTDDGAPAAGAVID
VWHSTPDGKYSGFHDQIPTDLYRGKVVADAQGKYAVRTTMPAPYQIPNKGPTGVLLEMMG
SHTWRPAHVHFKVRKDGFVPLTTQYYFEGGDWVDSDCCKGVAPDLVMPAKTEGGAQVMAI
DFVIERPREHA
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaacgaacgagtgaagcaggttgcgtccgcattggtggatgcgatccagaagaccctc
acggagcaacgcgtgacggaagaagagtggcgcgcgggcgtcggctacatgatgaaactg
gccgaggccaaggaaatggctctcctgctggacgtgttcttcaaccacacgatcgtcgac
ctcaaagcccaggccacgcgcggatccacgcccgcgatccagggcccgtatttcctggaa
ggcgccccggtggtcgccggcgccctgaagacctacgaggatgactcgcatcacccgctc
gtgatccgcggcgccgtgcgcacggacgatggcgcgccagccgcgggagccgtgatcgac
gtgtggcactccacgcccgacggcaagtacagcggctttcatgaccagatcccgaccgac
ttgtaccgcggcaaggtcgtggccgatgcgcagggcaagtacgccgtgcgcaccaccatg
cccgccccgtaccagatcccgaacaagggaccgaccggcgtgctgcttgaaatgatggga
agccatacgtggcgtcccgcgcacgtgcacttcaaggtgcgcaaggacgggttcgtgccg
ctgaccacgcagtactacttcgaaggcggcgactgggtcgacagcgactgctgcaagggt
gtcgcaccggacctggtcatgccggcaaagaccgagggcggcgcgcaggtgatggccatc
gacttcgtcatcgaacgaccccgggagcacgcatga

DBGET integrated database retrieval system