Cronobacter universalis: AFK65_07730 Help Entry AFK65_07730       CDS       T04063                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cui  Cronobacter universalis Pathway cui01100   Metabolic pathways cui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AFK65_07730    00074 Mycolic acid biosynthesis     AFK65_07730   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AFK65_07730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  ALB54558 UniProt:  A0AAC8VPG8 LinkDB All DBs Position 1692783..1693019 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system