Cupriavidus sp. KK10: KB879_24745 Help Entry KB879_24745       CDS       T08941                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cuk  Cupriavidus sp. KK10 Pathway cuk00998   Biosynthesis of various antibiotics cuk01100   Metabolic pathways cuk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cuk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KB879_24745 (acpP)    00074 Mycolic acid biosynthesis     KB879_24745 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KB879_24745 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 MAP Motif Other DBs NCBI-ProteinID:  QUN27258 LinkDB All DBs Position complement(5312165..5312404) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacaacgcgtcaagaaaatcgtggcagaacagcttggcgtggccgag gcagacatcaagaacgaatcgtcgttcgtgaacgatctcggtgcggactcgctggacacg gttgaactcgtgatggcgttggaagatgaattcggcatggaaattcctgatgaggaagcc gaaaagatcacgaccgtgcaacaggctatcgactacgccaccgcgcacgtcaaggcctaa

DBGET integrated database retrieval system