Cupriavidus sp. KK10: KB879_30795 Help Entry KB879_30795       CDS       T08941                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism cuk  Cupriavidus sp. KK10 Brite KEGG Orthology (KO) [BR:cuk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cuk03032]     KB879_30795    03036 Chromosome and associated proteins [BR:cuk03036]     KB879_30795    03400 DNA repair and recombination proteins [BR:cuk03400]     KB879_30795 DNA replication proteins [BR:cuk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     KB879_30795 Chromosome and associated proteins [BR:cuk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     KB879_30795 DNA repair and recombination proteins [BR:cuk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       KB879_30795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg Lmo2446-like_N RsdA_SigD_bd Motif Other DBs NCBI-ProteinID:  QUN28354 LinkDB All DBs Position 6600992..6601270 Genome browser AA seq 92 aa AA seqDB search MTKTELIDAIAAGVDGLTKAKAEQALNVTLSAIMDAVAKGDTLSLIGFGTFSKGERGERM ARNPRTGEEIKVEAAKTVKFKAGQKFKDAVNQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacgaaaaccgaactgatcgacgctatcgcagccggggtggacggtctgaccaaggcc aaggcagaacaggcactgaacgtgaccctgtcggccatcatggacgcagtggccaagggc gacacgctgagcctcattggctttggcacgttcagcaagggcgagcgtggcgagcgcatg gcgcgcaacccgcgtaccggcgaagaaatcaaggtcgaagcagccaagaccgtgaagttc aaggctggccagaagttcaaggacgctgtcaaccagtga

DBGET integrated database retrieval system