Cupriavidus sp. KK10: KB879_32155 Help Entry KB879_32155       CDS       T08941                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism cuk  Cupriavidus sp. KK10 Brite KEGG Orthology (KO) [BR:cuk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cuk03036]     KB879_32155    03400 DNA repair and recombination proteins [BR:cuk03400]     KB879_32155 Chromosome and associated proteins [BR:cuk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     KB879_32155 DNA repair and recombination proteins [BR:cuk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       KB879_32155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N PRIMA1 Motif Other DBs NCBI-ProteinID:  QUN32357 LinkDB All DBs Position p1:complement(210355..210615) Genome browser AA seq 86 aa AA seqDB search MTAKTERADAIRWIQARMDDYGLTLEDLDAAGCFAPPPPPPPPAPAAPVVCYRNAEGLTW DGQGEMPSWLKRAVNAGQSVEFFRVG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacagcaaagactgagcgggcggacgcgatccgctggatccaggcgcggatggacgac tacgggctcaccctcgaagacctcgacgcggcggggtgcttcgcgccgccgcctccacct ccaccgcccgcaccagcggcgccggtggtctgctaccgcaatgcggaggggctgacctgg gacgggcagggcgagatgccgtcatggctcaagcgcgcggtcaatgcggggcagagcgtt gagtttttccgggttggatag

DBGET integrated database retrieval system