Cupriavidus sp. KK10: KB879_37805 Help Entry KB879_37805       CDS       T08941                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cuk  Cupriavidus sp. KK10 Pathway cuk00998   Biosynthesis of various antibiotics cuk01100   Metabolic pathways cuk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cuk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KB879_37805    00074 Mycolic acid biosynthesis     KB879_37805   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KB879_37805 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QUN32016 LinkDB All DBs Position p1:complement(1379944..1380192) Genome browser AA seq 82 aa AA seqDB search MNNASIRAIVVSTLREIAPEIEPQALRPDRPLRREVDLDSMDWLRFLLALHEKLKVEIPE SDYGRLVTLDDVVSYLEAAATR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaacaacgccagtatccgcgccatcgtcgtgtccacgttacgcgagatcgcccctgag atcgagccgcaggccctgcgcccagatcgtccgctgcgcagggaggtcgaccttgattcc atggactggctccgcttcctgcttgccctgcatgagaaattgaaggtggagattccggag tcagactacggccggctcgtcacgcttgacgatgtcgtgtcctacctggaagccgcagca acacgttga

DBGET integrated database retrieval system