Cupriavidus malaysiensis: BKK80_27700 Help Entry BKK80_27700       CDS       T04978                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cup  Cupriavidus malaysiensis Pathway cup00998   Biosynthesis of various antibiotics cup01100   Metabolic pathways cup01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cup00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BKK80_27700    00074 Mycolic acid biosynthesis     BKK80_27700   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BKK80_27700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOZ09531 LinkDB All DBs Position 2:complement(1843160..1843420) Genome browser AA seq 86 aa AA seqDB search MNELETELARLIIGELDITDIALADVRPDTPLYGEGFGLDSIDILEIALLVSKKYGFELR SDNPDNKRIFQSLGSLAAYTQQQRSR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgaactggaaaccgaactcgcgcgcctgatcatcggcgaactcgacatcacggat atcgcgctggccgacgtccggcccgatacaccgctctatggcgagggattcggcctggac tcgatcgacatcctcgagatcgcgctgctcgtgtccaagaaatacggcttcgaactgcgc tcggacaatccggacaacaagcgcattttccagtcgctgggcagcctggcggcctatacg caacaacagcggtcacgctga

DBGET integrated database retrieval system