Cupriavidus sp. Agwp_2: LPA45_03410 Help Entry LPA45_03410       CDS       T11307                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism cupa  Cupriavidus sp. Agwp_2 Brite KEGG Orthology (KO) [BR:cupa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cupa03110]     LPA45_03410 (groES)    03029 Mitochondrial biogenesis [BR:cupa03029]     LPA45_03410 (groES) Chaperones and folding catalysts [BR:cupa03110]  Heat shock proteins   HSP10    LPA45_03410 (groES) Mitochondrial biogenesis [BR:cupa03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     LPA45_03410 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  XDA00654 LinkDB All DBs Position 737512..737802 Genome browser AA seq 96 aa AA seqDB search MNLRPLHDRVIVKRLDNETKTASGIVIPDNAAEKPDQGEVLAIGPGKKDDKGNNIALDVK VGDRVLFGKYAGQGVKVDGQELLVMREEDIMAVVNK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacctgcgtcctctgcacgaccgcgtgatcgtgaagcgtctggacaacgaaaccaag accgcgtccggtatcgtgattcccgacaacgctgccgagaagcccgatcaaggcgaagtg ctggcgattggtcccggcaagaaggatgacaagggcaacaacattgccctggacgtcaag gtcggcgatcgcgtgctgttcggcaagtatgccggccagggcgtgaaggtggatggccag gaactgctggtcatgcgcgaagaagacatcatggccgtggtcaacaagtaa

DBGET integrated database retrieval system