KEGG   Cupriavidus sp. P-10: CTP10_R02750
Entry
CTP10_R02750      CDS       T10694                                 
Symbol
gpmA
Name
(GenBank) 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cupp  Cupriavidus sp. P-10
Pathway
cupp00010  Glycolysis / Gluconeogenesis
cupp00260  Glycine, serine and threonine metabolism
cupp00680  Methane metabolism
cupp01100  Metabolic pathways
cupp01110  Biosynthesis of secondary metabolites
cupp01120  Microbial metabolism in diverse environments
cupp01200  Carbon metabolism
cupp01230  Biosynthesis of amino acids
Module
cupp_M00002  Glycolysis, core module involving three-carbon compounds
cupp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cupp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTP10_R02750 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    CTP10_R02750 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTP10_R02750 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cupp04131]
    CTP10_R02750 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cupp04147]
    CTP10_R02750 (gpmA)
Enzymes [BR:cupp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTP10_R02750 (gpmA)
Membrane trafficking [BR:cupp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CTP10_R02750 (gpmA)
Exosome [BR:cupp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTP10_R02750 (gpmA)
  Exosomal proteins of melanoma cells
   CTP10_R02750 (gpmA)
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: BDB22948
LinkDB
Position
1:complement(293171..293917)
AA seq 248 aa
MYKLVLIRHGESTWNLENRFTGWVDVDLTETGAAQARQSGKLLKEAGFDFDIAYTSVLKR
AIRTLWHVQDEMDLMWIPVRNEWRLNERHYGALAGLNKAETAAKFGDEQVLVWRRSYDTP
PPALEPTDPRASFDDPRYANVPRNEIPLTECLKDTVARVMPLWNESIAPDIKSGRRVVIA
AHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDADLRPIRHYYLGDQDAIAASLAA
VANQGKAR
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtacaagcttgtccttatccgccacggcgaatcgacctggaaccttgaaaaccgcttc
accggctgggtcgacgtcgacctgaccgagaccggcgccgcacaggcccgccagtcgggc
aaactgctcaaggaagccggcttcgacttcgatatcgcctacacctcggtgctcaagcgc
gccatccgcaccctgtggcatgtgcaggatgaaatggacctgatgtggatcccggtgcgc
aacgaatggcgcctgaacgaacgccactatggcgcgctggccggcctgaacaaggccgag
accgccgccaagttcggcgacgagcaggtgctggtgtggcgccgcagctatgacacgccg
ccccctgcactggaaccgaccgatccgcgtgcctcgttcgacgatccgcgctatgccaac
gtgccgcgcaacgagatcccgctgaccgaatgcctgaaggacacggtggcccgcgtgatg
ccgctgtggaacgaatctatcgctcccgacatcaaatccggcaggcgtgtggtcattgcc
gcgcacggcaacagcatccgcgcgctggtgaagtacctggaccagatttcggatgacgat
atcgttggactcaatatccccaacggcaccccgctcgtgtacgagctggacgccgacctg
cgcccgatccgccactactacctgggcgaccaggacgccatcgccgcttcgctggcggcc
gtggccaaccagggcaaggcgcgctga

DBGET integrated database retrieval system