Cupriavidus sp. P-10: CTP10_R06600 Help Entry CTP10_R06600      CDS       T10694                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism cupp  Cupriavidus sp. P-10 Brite KEGG Orthology (KO) [BR:cupp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cupp03110]     CTP10_R06600 (groES)    03029 Mitochondrial biogenesis [BR:cupp03029]     CTP10_R06600 (groES) Chaperones and folding catalysts [BR:cupp03110]  Heat shock proteins   HSP10    CTP10_R06600 (groES) Mitochondrial biogenesis [BR:cupp03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     CTP10_R06600 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  BDB23331 LinkDB All DBs Position 1:714925..715215 Genome browser AA seq 96 aa AA seqDB search MNLRPLHDRVIVKRLDNETKTASGIVIPDNAAEKPDQGEVLAIGPGKKDDKGNNIALDVK VGDRVLFGKYAGQGVKVDGQELLVMREEDIMAVVNK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacctgcgtcctctgcacgaccgcgtgatcgtgaagcgtctggacaacgaaaccaag accgcgtccggtatcgtgattcccgacaacgctgccgagaagcccgatcaaggcgaagtg ctggcgattggtcccggcaagaaggatgacaagggcaacaacattgccctggacgtcaag gtcggcgatcgcgtgctgttcggcaagtatgccggccagggcgtgaaggtggatggccag gaactgctggtcatgcgcgaagaagacatcatggccgtggtcaacaagtaa

DBGET integrated database retrieval system