Cupriavidus sp. P-10: CTP10_R37910 Help Entry CTP10_R37910      CDS       T10694                                  Name (GenBank) phenol hydroxylase subunit P4   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism cupp  Cupriavidus sp. P-10 Pathway cupp00361   Chlorocyclohexane and chlorobenzene degradation cupp00362   Benzoate degradation cupp00623   Toluene degradation cupp01100   Metabolic pathways cupp01120   Microbial metabolism in diverse environments cupp01220   Degradation of aromatic compounds Module cupp_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:cupp00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CTP10_R37910    00361 Chlorocyclohexane and chlorobenzene degradation     CTP10_R37910    00623 Toluene degradation     CTP10_R37910 Enzymes [BR:cupp01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      CTP10_R37910     1.14.13.244  phenol 2-monooxygenase (NADH)      CTP10_R37910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  BDB26391 LinkDB All DBs Position 2:396152..396511 Genome browser AA seq 119 aa AA seqDB search MPVVSIGDYTFAPADREDAFHGNRLLYIGWDGHLLFCAPHCFPFAPSMPLRAVVQDVLPA VYGYHPDFARIDWSTVQWLRGGQPWQPDLDRTLEENGLGHKDVIRFRTPGLDGIAGSGS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgcccgtcgtatccatcggcgactacaccttcgcgccggccgaccgcgaagacgcattc cacggcaaccgcctgctctacatcggctgggacggccacctgctgttctgcgcgccgcac tgctttccgttcgcgccgtcgatgccgctgcgcgcggtggtgcaggacgtgctgcccgcg gtctacggctatcacccagacttcgcccgcattgactggagcacggtgcagtggctgcgc ggcggccagccgtggcagcccgacctggaccgcacgctggaagagaacggcctgggccac aaggacgtgatccgcttccgcacgccggggctggacggcatcgccggcagcggcagctga

DBGET integrated database retrieval system