Cupriavidus sp. P-10: CTP10_R47140 Help Entry CTP10_R47140      CDS       T10694                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism cupp  Cupriavidus sp. P-10 Brite KEGG Orthology (KO) [BR:cupp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cupp03036]     CTP10_R47140    03400 DNA repair and recombination proteins [BR:cupp03400]     CTP10_R47140 Chromosome and associated proteins [BR:cupp03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     CTP10_R47140 DNA repair and recombination proteins [BR:cupp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       CTP10_R47140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Motif Other DBs NCBI-ProteinID:  BDB27309 LinkDB All DBs Position 2:1430622..1430885 Genome browser AA seq 87 aa AA seqDB search MSPELERRDAITWIRVQMARHGLHVEDLIAAGCFPAPAAAVAKGVVRYRNAEGQGWDGQG AMPDWLHRAVNAGQRLEHFAVSDAAFP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcccctgagcttgaacgacgagacgccattacctggattcgcgtgcaaatggcgcgc catgggttgcatgtcgaggacctgatcgcggccggctgcttcccggcaccagccgccgcg gtggcgaaaggcgtcgtccgctatcgcaacgccgaggggcagggctgggacgggcagggc gcgatgcccgactggctgcaccgtgcggtcaacgcgggacaacgcctggagcatttcgcg gtcagtgatgccgcgttcccgtga

DBGET integrated database retrieval system