Cupriavidus sp. P-10: CTP10_R76330 Help Entry CTP10_R76330      CDS       T10694                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism cupp  Cupriavidus sp. P-10 Brite Chromosome and associated proteins [BR:cupp03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     CTP10_R76330 DNA repair and recombination proteins [BR:cupp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       CTP10_R76330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  BDB30216 UniProt:  A0A388RH76 LinkDB All DBs Position pMTS2:complement(155345..155542) Genome browser AA seq 65 aa AA seqDB search MADYGLTLEELEAAGCFDPPPLPPSPPVVCYRNAEGLPWDGQGEMPSWLKRAVNAGQSVE FFRVG NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggccgactatgggttgacactggaggaactggaggcggcggggtgctttgatccgccc ccgctgccaccctcaccgccggtggtctgctatcgcaacgcggaagggctgccctgggac gggcagggcgagatgccgtcgtggctcaagcgggcggtcaatgcggggcagagcgtggag tttttccgggtcggataa

DBGET integrated database retrieval system