Cupriavidus sp. P-10: CTP10_R79050 Help Entry CTP10_R79050      CDS       T10694                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism cupp  Cupriavidus sp. P-10 Brite KEGG Orthology (KO) [BR:cupp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cupp03032]     CTP10_R79050    03036 Chromosome and associated proteins [BR:cupp03036]     CTP10_R79050    03400 DNA repair and recombination proteins [BR:cupp03400]     CTP10_R79050 DNA replication proteins [BR:cupp03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CTP10_R79050 Chromosome and associated proteins [BR:cupp03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CTP10_R79050 DNA repair and recombination proteins [BR:cupp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CTP10_R79050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg Lmo2446-like_N RsdA_SigD_bd Motif Other DBs NCBI-ProteinID:  BDB30488 UniProt:  A0A388RUS0 LinkDB All DBs Position pMTS3:40167..40445 Genome browser AA seq 92 aa AA seqDB search MTKTELIDAIAAGVDGLTKTKAEQALNVTLNTIMDSVAKGDTLNLIGFGSFSKGERSERM ARNPQTGEEIKVEAAKTVKFKAGQKFKDAVNN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacgaaaaccgaattgatcgacgccatcgcggctggcgtggacggcctgacgaagacc aaagcggaacaggcgctgaacgttaccctcaacaccatcatggattcggtggccaagggt gacacccttaacttgatcggctttggcagtttcagcaaaggcgaacgttcggagcgtatg gcgcgcaatcctcagactggcgaagaaatcaaggtcgaagcagccaagaccgtgaagttc aaggcgggccagaagttcaaggatgccgtcaacaactaa

DBGET integrated database retrieval system