KEGG   Cupriavidus sp. ISTL7: IC580_06430
Entry
IC580_06430       CDS       T10433                                 
Symbol
ldcA
Name
(GenBank) muramoyltetrapeptide carboxypeptidase
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
cupr  Cupriavidus sp. ISTL7
Brite
KEGG Orthology (KO) [BR:cupr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cupr01002]
    IC580_06430 (ldcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cupr01011]
    IC580_06430 (ldcA)
Enzymes [BR:cupr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     IC580_06430 (ldcA)
Peptidases and inhibitors [BR:cupr01002]
 Serine peptidases
  Family S66
   IC580_06430 (ldcA)
Peptidoglycan biosynthesis and degradation proteins [BR:cupr01011]
 Precursor biosynthesis
  Carboxypeptidase
   IC580_06430 (ldcA)
SSDB
Motif
Pfam: Peptidase_S66C Peptidase_S66
Other DBs
NCBI-ProteinID: QQE07931
LinkDB
Position
1:1445980..1446921
AA seq 313 aa
MNAPIEVRLLAPSGYPHDMAVATRGCDWLRAHGYRVANPEVLDRRHQRFGGTDDERLADL
HGIGTGASGALTLAVRGGYGLARLLPRIDFVRIAAQARRAATPIVGHSDFTAFQLAYLAK
AGGISLAGPMLLADFGAEPVDAFMWRHFEGLLRASSYTVDIDAPQDGGQPFSGEVAGTLW
GGNLAMLCSLLGTPYLPQVEGGILFLEDVNEPPYRVERMLLQLEQAGVLGAQRAILLGDF
SSYRVSDYDNGYDLPAVVAYLRERLPVPIVTGLPFGHCPRKLTLPVGGQGTLRASADGFT
LTMSGHPLLARPA
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaacgcgcccatcgaagtccgcctgcttgctccctccggctatccgcacgacatggcc
gtcgccacgcgcggctgcgactggctgcgggcgcacggctaccgcgtcgccaacccggag
gtgctggaccgccgccatcagcgcttcggcggcaccgacgacgagcggctggccgacctg
catggcatcggtaccggggcttccggcgcgctgacgctggcggtgcggggcggctacggc
ctggcgcgtctgctgccgcgcatcgatttcgtccgcatcgccgcgcaggcgcgccgcgcg
gccacgccgatcgtcggccacagcgatttcacggcattccagctggcgtatctggccaag
gcgggcggcatcagcctggccggtccgatgctgctggccgacttcggcgccgagccggtc
gatgccttcatgtggcggcatttcgaagggctgctgcgcgcgtcgtcctataccgtcgac
atcgacgcgccgcaggacggcggccagccgttctccggcgaggtggcgggcacgctgtgg
ggcggcaatctggcgatgctgtgcagcctgctgggcacgccgtatctgccgcaggtcgag
ggcggcatcctgtttctcgaggacgtcaacgagccgccgtaccgcgtcgagcgcatgctg
ctgcagctggaacaggccggcgtgctcggcgcgcagcgcgcgatcctgctgggcgatttc
tccagttaccgcgtcagcgactacgacaatggctacgacctgccggccgtggtggcctat
ctgcgggagcgcctgccggtgccgatcgtcaccgggctgccgttcggccactgcccgcgc
aagctgacgctgccggtgggcgggcagggcackcttcgggcctcggccgacggattcacg
ctgacgatgtcggggcacccgttgctggcccgcccggcctga

DBGET integrated database retrieval system