Cupriavidus sp. ISTL7: IC580_14595 Help Entry IC580_14595       CDS       T10433                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism cupr  Cupriavidus sp. ISTL7 Brite KEGG Orthology (KO) [BR:cupr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cupr03032]     IC580_14595    03036 Chromosome and associated proteins [BR:cupr03036]     IC580_14595    03400 DNA repair and recombination proteins [BR:cupr03400]     IC580_14595 DNA replication proteins [BR:cupr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     IC580_14595 Chromosome and associated proteins [BR:cupr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     IC580_14595 DNA repair and recombination proteins [BR:cupr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       IC580_14595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg HU-CCDC81_bac_2 Lmo2446-like_N Motif Other DBs NCBI-ProteinID:  QQE06872 UniProt:  A0A7T5CDR9 LinkDB All DBs Position 1:3420152..3420430 Genome browser AA seq 92 aa AA seqDB search MTKTELIDAIAAGVDGLTKAKAEQALNVTLNAIMDAVAKGDTLSLIGFGTFSQGERGERM ARNPRTGEEIKVEAAKTVKFKAGQKFKDAVNQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacgaaaaccgaactgatcgacgcgatcgcagcgggtgtggatggtctgaccaaggcc aaggccgagcaggcactgaacgtgacgctgaacgccatcatggacgccgtcgccaagggc gacacgctgagcctgatcggctttggcacgttcagccagggcgagcgtggcgagcgcatg gcccgcaacccgcgtaccggcgaagagatcaaggtcgaagcggccaagacggtcaagttc aaggccggccagaagttcaaggacgccgtcaatcagtaa

DBGET integrated database retrieval system