Cupriavidus sp. ISTL7: IC580_22510 Help Entry IC580_22510       CDS       T10433                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism cupr  Cupriavidus sp. ISTL7 Brite KEGG Orthology (KO) [BR:cupr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cupr03036]     IC580_22510    03400 DNA repair and recombination proteins [BR:cupr03400]     IC580_22510 Chromosome and associated proteins [BR:cupr03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     IC580_22510 DNA repair and recombination proteins [BR:cupr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       IC580_22510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N YL1_C Motif Other DBs NCBI-ProteinID:  QQE08862 LinkDB All DBs Position 2:complement(1772154..1772456) Genome browser AA seq 100 aa AA seqDB search MATYKQLLAEKEKLEAQLEEARQTEVATVIAQIQQLMEDYGLTAEDLAPRRRGRPRKSAA RSGTPAPAKYRDPKTGKTWSGRGRAPAWLGKNRDRFLITE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcgacttacaaacaattgctggcagaaaaggaaaaactcgaagcgcaactcgaggaa gccaggcaaaccgaagtggcgacggtgatcgcccagatccagcaactgatggaggattac ggtttgacggccgaggacctcgcgccgcgccgccgtggccgtcctcgcaaatcggcggcc cgttccggtacgccggccccggccaaatatcgcgatccgaagaccggcaagacctggtcc ggccgcggccgcgcaccggcatggctgggcaagaatcgggatcgtttcctgattaccgag taa

DBGET integrated database retrieval system