Cupriavidus sp. ISTL7: IC580_22905 Help Entry IC580_22905       CDS       T10433                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism cupr  Cupriavidus sp. ISTL7 Brite KEGG Orthology (KO) [BR:cupr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cupr03036]     IC580_22905    03400 DNA repair and recombination proteins [BR:cupr03400]     IC580_22905 Chromosome and associated proteins [BR:cupr03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     IC580_22905 DNA repair and recombination proteins [BR:cupr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       IC580_22905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Diox-like_N Motif Other DBs NCBI-ProteinID:  QQE08922 LinkDB All DBs Position 2:1861332..1861637 Genome browser AA seq 101 aa AA seqDB search MATYQEIVQKINELQKQAEEIKAREQAAVIDDIRKKIEEYGLTAEDLGFGSKAVPGKKTA RKVPVRYRDSAGNTWTGRGKRPGWLTQALASGKSIDDFLVR NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcaacctatcaggaaatcgttcagaaaatcaacgaattgcagaagcaagccgaagag atcaaggctcgagagcaggcggcggtaatcgacgatatccgcaagaaaatcgaagaatat ggcttgaccgccgaagatctcggttttggcagcaaggcggtacccggcaagaaaaccgcg cgcaaagtgcccgtgcgctatcgcgacagcgctggcaatacctggacgggccgcggcaag cgccccggctggctgacccaggcgctggcctccggaaaatcgatcgacgacttcctggtg cgataa

DBGET integrated database retrieval system