Corynebacterium urealyticum DSM 7109: cu0711 Help Entry cu0711            CDS       T00685                                  Name (GenBank) ATP synthase C chain   KO K02110   F-type H+-transporting ATPase subunit c Organism cur  Corynebacterium urealyticum DSM 7109 Pathway cur00190   Oxidative phosphorylation cur01100   Metabolic pathways Module cur_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:cur00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     cu0711  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cur00194]     cu0711 Photosynthesis proteins [BR:cur00194]  Photosystem and electron transport system   F-type ATPase [OT]    cu0711 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  CAQ04671 UniProt:  B1VFY2 LinkDB All DBs Position 850366..850608 Genome browser AA seq 80 aa AA seqDB search MNDILFLAQDTVTKFEGFGTIGYGLAAIGSAIGVGNVAGKTAEAMARQPEMAGQLRTTMF LGIAFAEALALIGFVAGFLF NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaacgacatcctcttcctggctcaggacactgtcaccaagttcgagggcttcggcacc atcggctacggcctcgcagcaatcggttctgcaatcggtgtgggtaacgtcgcaggcaag accgctgaggctatggcacgtcagccggagatggctggccagctgcgcaccaccatgttc ctgggtatcgcgttcgctgaggccctggccctgattggtttcgtcgccggcttcctgttc taa

DBGET integrated database retrieval system