KEGG   Corynebacterium uterequi: CUTER_10850
Entry
CUTER_10850       CDS       T03957                                 
Symbol
ssb
Name
(GenBank) single-strand binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
cut  Corynebacterium uterequi
Pathway
cut03030  DNA replication
cut03430  Mismatch repair
cut03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cut00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CUTER_10850 (ssb)
   03430 Mismatch repair
    CUTER_10850 (ssb)
   03440 Homologous recombination
    CUTER_10850 (ssb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cut03032]
    CUTER_10850 (ssb)
   03400 DNA repair and recombination proteins [BR:cut03400]
    CUTER_10850 (ssb)
   03029 Mitochondrial biogenesis [BR:cut03029]
    CUTER_10850 (ssb)
DNA replication proteins [BR:cut03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    CUTER_10850 (ssb)
DNA repair and recombination proteins [BR:cut03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     CUTER_10850 (ssb)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CUTER_10850 (ssb)
Mitochondrial biogenesis [BR:cut03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    CUTER_10850 (ssb)
SSDB
Motif
Pfam: SSB tRNA_anti-codon tRNA_anti_2 S-Me-THD_C
Other DBs
NCBI-ProteinID: AKK12131
UniProt: A0A0G3HFP3
LinkDB
Position
complement(2347205..2347834)
AA seq 209 aa
MAQGDTPITIVGNVVADPELRFTQGGAAVANFRVASTPRRFNSQTNQWEDGEALFLTCNV
WRQAAENVAESLKKGMRVIVTGKLRQRSWDDRDGNKRTVFEVEVDEVGPSLKFASAQVNR
NPREGGSGNYGGGNYGGGNSGGGNNYGGGNSGGYQNNFGGGNSGGGNNYGGFGGNQFQGG
QQSHQPPQDPWNSAPEAGSAPDGIDNPPF
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcacagggcgacactccgatcaccatcgtcggcaatgtggttgctgatccggaactt
cgtttcacccaagggggtgcggcggtcgctaatttccgcgtcgcctctaccccgcgtcgc
ttcaactcccagacgaaccagtgggaggacggcgaggcgctgtttctcacctgcaatgtg
tggcggcaggcggccgaaaacgtcgctgagtcgctgaagaagggcatgcgcgtcatcgtg
accggtaagctgcgccagcgcagctgggacgatcgcgacggcaacaagcgcacggtcttc
gaggttgaggtcgacgaggtgggcccgtccctgaagttcgcctccgcccaggtcaaccgc
aacccgcgtgagggcggtagcggtaactacggcggtggcaactatggtggcggcaactcc
ggcggcggaaacaactacggcgggggtaactccggcggctaccagaacaatttcggcggg
ggtaactccggcggcggaaacaactacggcggattcggcggcaaccaattccagggtggg
cagcagtcccaccagccgccgcaggacccgtggaactccgcccccgaggccggcagcgcg
cctgacggcatcgataacccgccgttctag

DBGET integrated database retrieval system