Cupriavidus sp. USMAA2-4: BKK79_02360 Help Entry BKK79_02360       CDS       T05072                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism cuu  Cupriavidus sp. USMAA2-4 Pathway cuu00190   Oxidative phosphorylation cuu01100   Metabolic pathways cuu02020   Two-component system Module cuu_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:cuu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BKK79_02360  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BKK79_02360 Enzymes [BR:cuu01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BKK79_02360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AOY90783 UniProt:  A0A1D9GT25 LinkDB All DBs Position 1:complement(527661..527774) Genome browser AA seq 37 aa AA seqDB search MWYFSWVLGVGFAVLLPVLNAMWGEASDARTQRAEER NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcagctgggttctaggtgtcggcttcgccgtgctgctccccgtactcaat gccatgtggggtgaagccagcgacgcgcgcacacagcgcgccgaagagcggtga

DBGET integrated database retrieval system