Cupriavidus sp. USMAA2-4: BKK79_11325 Help Entry BKK79_11325       CDS       T05072                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism cuu  Cupriavidus sp. USMAA2-4 Brite KEGG Orthology (KO) [BR:cuu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cuu03032]     BKK79_11325    03036 Chromosome and associated proteins [BR:cuu03036]     BKK79_11325    03400 DNA repair and recombination proteins [BR:cuu03400]     BKK79_11325 DNA replication proteins [BR:cuu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BKK79_11325 Chromosome and associated proteins [BR:cuu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BKK79_11325 DNA repair and recombination proteins [BR:cuu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BKK79_11325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg Lmo2446-like_N RsdA_SigD_bd Motif Other DBs NCBI-ProteinID:  AOY92301 UniProt:  A0A1D9GXM6 LinkDB All DBs Position 1:complement(2587107..2587385) Genome browser AA seq 92 aa AA seqDB search MTKTELIDAIAAGVDGLTKAKAEQALNVTLSAIMDAVAKGDTLSLIGFGTFSQGERGERM ARNPRTGEEIKVEAAKTVKFKAGQKFKDAVNQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacgaaaaccgaactgatcgacgccatcgccgccggcgtggacgggctcaccaaggcc aaggcagaacaggcactgaacgtgaccctgtcggccatcatggatgccgtggccaagggc gatacgctcagcctgatcggctttggtacgttcagccagggcgagcgcggtgagcgcatg gcacgcaacccgcgcaccggcgaagaaatcaaggtcgaggccgccaagaccgtgaagttc aaggccggccagaagttcaaggacgccgtcaaccagtga

DBGET integrated database retrieval system