Cupriavidus sp. USMAA2-4: BKK79_17355 Help Entry BKK79_17355       CDS       T05072                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cuu  Cupriavidus sp. USMAA2-4 Pathway cuu00998   Biosynthesis of various antibiotics cuu01100   Metabolic pathways cuu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cuu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BKK79_17355    00074 Mycolic acid biosynthesis     BKK79_17355   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BKK79_17355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 MAP Motif Other DBs NCBI-ProteinID:  AOY93373 UniProt:  A0A1D9H0E3 LinkDB All DBs Position 1:3899781..3900020 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacaacgcgtcaagaaaatcgtggcagaacagcttggcgtggccgag gcggacatcaagaacgaatcgtcgttcgtgaacgacctgggcgccgactcgctcgacacg gttgaactcgtgatggcgttggaagatgaattcggcatggaaattcccgatgaggaagcc gaaaagatcaccaccgtgcagcaggcgatcgactacgccaccgcgcacgtcaaggcctga

DBGET integrated database retrieval system