Cupriavidus sp. USMAA2-4: BKK79_18250 Help Entry BKK79_18250       CDS       T05072                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism cuu  Cupriavidus sp. USMAA2-4 Pathway cuu02024   Quorum sensing cuu03018   RNA degradation Brite KEGG Orthology (KO) [BR:cuu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BKK79_18250  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BKK79_18250  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cuu03019]     BKK79_18250    03036 Chromosome and associated proteins [BR:cuu03036]     BKK79_18250 Messenger RNA biogenesis [BR:cuu03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BKK79_18250 Chromosome and associated proteins [BR:cuu03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BKK79_18250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 SRP14 Motif Other DBs NCBI-ProteinID:  AOY93522 LinkDB All DBs Position 1:4095797..4096036 Genome browser AA seq 79 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARAVNFRVDDSAEG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaactgctacaagacccgttcctgaacgcgctgcgcaaggagcac gtgccggtttccatctatctcgtcaatggcatcaagctgcagggcaatatcgagtccttc gaccagtacgtcgtcctgctgcgcaacacggtgacgcagatggtctacaagcatgcgatc tccaccgtcgtcccggcgcgcgcggtcaatttccgcgtcgatgattcggccgaaggctga

DBGET integrated database retrieval system