Cupriavidus sp. USMAA2-4: BKK79_35365 Help Entry BKK79_35365       CDS       T05072                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cuu  Cupriavidus sp. USMAA2-4 Pathway cuu00998   Biosynthesis of various antibiotics cuu01100   Metabolic pathways cuu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cuu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BKK79_35365    00074 Mycolic acid biosynthesis     BKK79_35365   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BKK79_35365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOY96787 UniProt:  A0A1D9HAC7 LinkDB All DBs Position 2:complement(3520497..3520766) Genome browser AA seq 89 aa AA seqDB search MKALEEDIKELIIASLSLEDLSPADIDAQAPLFVEGLGLDSIDALELGLALQKRFGVKLD GDKEAVRARFASVSALAAFIAAQRSEAAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgaaggcgcttgaagaagacatcaaggaactgatcattgcatcgctgtcgctcgaagac ctgagcccggccgacatcgacgcgcaggcgccgctgttcgtcgaggggctcggcctcgat tcgatcgacgcgctcgagctgggcctggccctgcagaagcgcttcggcgtcaagctcgac ggcgacaaggaagcggtgcgggcacgctttgccagcgtctccgcgctggctgccttcatc gccgcgcaacgcagcgaggcggcggcctga

DBGET integrated database retrieval system