Cupriavidus sp. USMAA2-4: BKK79_37705 Help Entry BKK79_37705       CDS       T05072                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism cuu  Cupriavidus sp. USMAA2-4 Brite KEGG Orthology (KO) [BR:cuu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cuu03036]     BKK79_37705    03400 DNA repair and recombination proteins [BR:cuu03400]     BKK79_37705 Chromosome and associated proteins [BR:cuu03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BKK79_37705 DNA repair and recombination proteins [BR:cuu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BKK79_37705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF6471 Motif Other DBs NCBI-ProteinID:  AOY97666 UniProt:  A0A1D9HC68 LinkDB All DBs Position unnamed1:complement(350636..350920) Genome browser AA seq 94 aa AA seqDB search MPIAYPGAQSLRERADAVLWIKSQMARLGLSYEQLLAAGCFAAPGVAGGSASGVIKFRDA AGHAWNGVGDLPDWLQRAVNAGQSIEHFRAEQKV NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgccaatcgcctatcctggggcccaatccttgcgcgagcgcgccgacgcagtcctgtgg atcaagtcacagatggcccggctcgggctgagctatgagcaactcctggcggcaggctgt ttcgcggcgcccggcgtagccggaggctctgcctcaggcgtcatcaaatttcgggacgcc gctggccacgcctggaatggcgtgggcgacctgccggattggttgcagcgcgcggtcaat gcggggcagtcgatcgagcatttccgcgcagagcaaaaggtatag

DBGET integrated database retrieval system