Chromobacterium vaccinii: BKX93_15610 Help Entry BKX93_15610       CDS       T04565                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism cvc  Chromobacterium vaccinii Brite KEGG Orthology (KO) [BR:cvc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cvc03036]     BKX93_15610 Chromosome and associated proteins [BR:cvc03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     BKX93_15610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  AOZ51286 UniProt:  A0A1D9LJ30 LinkDB All DBs Position 3375612..3375884 Genome browser AA seq 90 aa AA seqDB search MNKLNATLLLMAVFSAWSVVTSTHVSRKLYSDLQKETKSGQQLEVEFGQLQLEQSTWGAH AVIEKAASTRLDMHTPDPRQIQVITAKGAL NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagctcaacgcgacgctgctgctgatggccgtgttctccgcctggtcggtggtg acgtccacgcacgtgtcgcgcaagctctacagcgacttgcagaaggaaaccaagtcgggg cagcagctggaggtggagttcggccagctgcagctggagcagagcacctggggcgcgcac gcggtgatcgagaaagccgcctccacccgcctcgacatgcacacgcctgatccgcgccag atccaggtgatcacggcgaagggagcgctgtga

DBGET integrated database retrieval system