Charadrius vociferus (killdeer): 104282562 Help Entry 104282562         CDS       T08577                                  Symbol CALM2 Name (RefSeq) calmodulin   KO K02183   calmodulin Organism cvf  Charadrius vociferus (killdeer) Pathway cvf04020   Calcium signaling pathway cvf04070   Phosphatidylinositol signaling system cvf04114   Oocyte meiosis cvf04218   Cellular senescence cvf04261   Adrenergic signaling in cardiomyocytes cvf04270   Vascular smooth muscle contraction cvf04371   Apelin signaling pathway cvf04625   C-type lectin receptor signaling pathway cvf04744   Phototransduction cvf04910   Insulin signaling pathway cvf04912   GnRH signaling pathway cvf04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cvf00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     104282562 (CALM2)    04020 Calcium signaling pathway     104282562 (CALM2)    04070 Phosphatidylinositol signaling system     104282562 (CALM2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104282562 (CALM2)    04218 Cellular senescence     104282562 (CALM2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104282562 (CALM2)   09152 Endocrine system    04910 Insulin signaling pathway     104282562 (CALM2)    04912 GnRH signaling pathway     104282562 (CALM2)    04916 Melanogenesis     104282562 (CALM2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     104282562 (CALM2)    04270 Vascular smooth muscle contraction     104282562 (CALM2)   09157 Sensory system    04744 Phototransduction     104282562 (CALM2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cvf01009]     104282562 (CALM2)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cvf04131]     104282562 (CALM2)    03036 Chromosome and associated proteins [BR:cvf03036]     104282562 (CALM2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cvf04147]     104282562 (CALM2) Protein phosphatases and associated proteins [BR:cvf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104282562 (CALM2) Membrane trafficking [BR:cvf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104282562 (CALM2) Chromosome and associated proteins [BR:cvf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104282562 (CALM2) Exosome [BR:cvf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104282562 (CALM2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 EFhand_Ca_insen Dockerin_1 DUF1103 DUF5580_M Caleosin FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  104282562 NCBI-ProteinID:  XP_009878968 LinkDB All DBs Position Unknown AA seq 225 aa AA seqDB search MTEFRVFLKEFGISSGLGLMVLTDANHSGEKRIINHSLAYSFHLILSSELAGLILVPNLA VQLYFLQPENILLQPPKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP TEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAA ELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 678 nt NT seq  +upstreamnt  +downstreamnt atgactgagtttagggtgtttctgaaagaatttggtatttccagcgggctcggcctgatg gtcctgacagatgccaaccattcaggtgaaaagagaataattaaccattctttggcttac agctttcaccttatcctgtcatcagagctggcaggtcttattctggttcccaatcttgct gtccagttgtactttctccagcctgaaaacatccttcttcagcctcccaaggctgatcaa ctgacagaagagcagattgcagaattcaaagaagctttttcactatttgacaaggatggt gatggtactataactacaaaggagttggggacagtgatgagatcgcttggtcaaaacccc acagaagcagagctacaggatatgatcaatgaagtagatgctgatggcaatggcacaatt gacttcccagagtttctgacaatgatggcaagaaaaatgaaagatacagatagtgaagaa gaaattagagaagcgttccgtgtgtttgacaaggatggtaacggttacattagtgctgca gaactccgtcatgtgatgacaaatcttggggagaagctaacagatgaagaagttgatgaa atgattagggaagcagacattgatggtgatggtcaagtaaactatgaagagtttgtacaa atgatgacagcgaagtga

DBGET integrated database retrieval system