Charadrius vociferus (killdeer): 104283626 Help Entry 104283626         CDS       T08577                                  Symbol CBY1 Name (RefSeq) protein chibby homolog 1   KO K23402   protein chibby 1 Organism cvf  Charadrius vociferus (killdeer) Pathway cvf04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:cvf00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104283626 (CBY1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cvf03037]     104283626 (CBY1) Cilium and associated proteins [BR:cvf03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    104283626 (CBY1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Chibby Taxilin LapA_dom Motif Other DBs NCBI-GeneID:  104283626 NCBI-ProteinID:  XP_009880129 UniProt:  A0A0A0ACG8 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPLFGSTFSPKKTPPRKCASLSNLHLLDRSTREIELGLEYGIPTMNLAGQSLKFENGQWV AESGSFTGDRREMQRLRKRNQQLEEENNLLRLKVDILLDMLSETTAESHLMEKELEELKS HSRRRK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccactcttcgggagcaccttcagcccgaagaagacccccccgaggaaatgcgcctcg ctctccaacctgcacttgctggacagatcgacccgtgagattgagctgggcctggagtat ggcatccccaccatgaacctcgctggtcagagccttaagtttgaaaatggccagtgggtg gcagaatcaggaagcttcacgggggaccgcagggaaatgcagcgcttgcgcaaacgaaac cagcagctagaggaagaaaacaacctccttcggctgaaagtggacattctgctggacatg ctctccgagaccacagctgagtcccacctcatggagaaggagctggaggaactgaagagc cacagccggaggaggaagtga

DBGET integrated database retrieval system