Charadrius vociferus (killdeer): 104283889 Help Entry 104283889         CDS       T08577                                  Symbol TXN Name (RefSeq) LOW QUALITY PROTEIN: thioredoxin   KO K03671   thioredoxin Organism cvf  Charadrius vociferus (killdeer) Pathway cvf04621   NOD-like receptor signaling pathway cvf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cvf00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104283889 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104283889 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cvf03110]     104283889 (TXN) Chaperones and folding catalysts [BR:cvf03110]  Protein folding catalysts   Protein disulfide isomerase    104283889 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA DIM1 OST3_OST6 Glutaredoxin Thioredoxin_7 Thioredoxin_9 Motif Other DBs NCBI-GeneID:  104283889 NCBI-ProteinID:  XP_009880427 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search KGGGKSLICSILFLXSEFEAELKSAGEKLIVVDFSATWCGPCKMIKPFFHSLCEKYGDVV FIEIDVDDAQDVATHCEVTCMPTFQFYKNGKKVQEFSGANKDKLEETIKSLV NT seq 339 nt NT seq  +upstreamnt  +downstreamnt aaaggaggggggaagtcattaatatgttcaattctttttctatagtctgaatttgaggca gaactgaaatctgctggtgagaagctcatagtagtggatttctctgccacatggtgtgga ccatgcaaaatgatcaagccctttttccacagtttgtgtgagaagtacggtgatgtggtg ttcatcgaaattgatgtggatgatgcccaggatgttgctacacactgtgaagtgacgtgc atgccaacgttccagttctacaagaatggaaagaaggtgcaggagttctctggggccaat aaagataagctggaagagaccattaaaagtctagtctga

DBGET integrated database retrieval system