Charadrius vociferus (killdeer): 104285463 Help Entry 104285463         CDS       T08577                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism cvf  Charadrius vociferus (killdeer) Pathway cvf04010   MAPK signaling pathway cvf04020   Calcium signaling pathway cvf04114   Oocyte meiosis cvf04218   Cellular senescence cvf04310   Wnt signaling pathway cvf04370   VEGF signaling pathway cvf04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:cvf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104285463 (PPP3R1)    04310 Wnt signaling pathway     104285463 (PPP3R1)    04370 VEGF signaling pathway     104285463 (PPP3R1)    04020 Calcium signaling pathway     104285463 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104285463 (PPP3R1)    04218 Cellular senescence     104285463 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104285463 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cvf01009]     104285463 (PPP3R1) Protein phosphatases and associated proteins [BR:cvf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104285463 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  104285463 NCBI-ProteinID:  XP_009882228 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgctcgcactttgatgctgatgagataaaacgactaggaaagagatttaagaagctt gatttggacaactctggttctttgagtgtggaagagttcatgtctttacctgaattgcaa cagaacccattagtacagcgagtaatagatatatttgacacagacggaaatggagaagtg gacttcaaagaatttatagaaggagtctcccagttcagtgtcaaaggagataaggaacag aagttgaggtttgcttttcgcatttatgatatggacaaagatggttatatctcaaatgga gagctcttccaggtgctgaagatgatggttgggaacaatctcaaagacactcagttacag caaattgtagataaaaccataataaatgcagataaggatggtgatggaagaatatccttt gaagaattctgtgctgttgtaggaggcctagatatccacaaaaagatggttgtagacgtg tga

DBGET integrated database retrieval system