Charadrius vociferus (killdeer): 104288315 Help Entry 104288315         CDS       T08577                                  Name (RefSeq) interleukin-8 isoform X1   KO K10030   interleukin 8 Organism cvf  Charadrius vociferus (killdeer) Pathway cvf04060   Cytokine-cytokine receptor interaction cvf04218   Cellular senescence cvf04620   Toll-like receptor signaling pathway cvf04621   NOD-like receptor signaling pathway cvf04622   RIG-I-like receptor signaling pathway cvf05132   Salmonella infection cvf05164   Influenza A Brite KEGG Orthology (KO) [BR:cvf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104288315  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104288315  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104288315    04621 NOD-like receptor signaling pathway     104288315    04622 RIG-I-like receptor signaling pathway     104288315  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104288315   09171 Infectious disease: bacterial    05132 Salmonella infection     104288315  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cvf04052]     104288315    00536 Glycosaminoglycan binding proteins [BR:cvf00536]     104288315 Cytokines and neuropeptides [BR:cvf04052]  Cytokines   Chemokines    104288315 Glycosaminoglycan binding proteins [BR:cvf00536]  Heparan sulfate / Heparin   Chemokines    104288315 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 bPH_6 Motif Other DBs NCBI-GeneID:  104288315 NCBI-ProteinID:  XP_009885401 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MNSKLVAVLALFLISAAVSQGKTLARMGTELRCQCIATHSRFIPPKSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTASWVQLIVKAILAKAQLNSDSPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacagcaaacttgtggctgtcctggctcttttcctgatttcagcggctgtgtctcaa ggcaagaccctggcacggatgggaaccgagctgcggtgccagtgcatagccactcattcg aggttcatccctcctaaatccattcaagacgtgaagctgacacagagcggcccccactgc aagaacgttgaagtcatagctactctgaaggatggcagagaagtgtgcttggagcccact gcttcctgggtacagctgatcgtaaaggcaattctggccaaggctcagttgaattctgac tcgccactctga

DBGET integrated database retrieval system