Charadrius vociferus (killdeer): 104288316 Help Entry 104288316         CDS       T08577                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism cvf  Charadrius vociferus (killdeer) Pathway cvf04060   Cytokine-cytokine receptor interaction cvf04218   Cellular senescence cvf04620   Toll-like receptor signaling pathway cvf04621   NOD-like receptor signaling pathway cvf04622   RIG-I-like receptor signaling pathway cvf05132   Salmonella infection cvf05164   Influenza A Brite KEGG Orthology (KO) [BR:cvf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104288316  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104288316  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104288316    04621 NOD-like receptor signaling pathway     104288316    04622 RIG-I-like receptor signaling pathway     104288316  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104288316   09171 Infectious disease: bacterial    05132 Salmonella infection     104288316  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cvf04052]     104288316    00536 Glycosaminoglycan binding proteins [BR:cvf00536]     104288316 Cytokines and neuropeptides [BR:cvf04052]  Cytokines   Chemokines    104288316 Glycosaminoglycan binding proteins [BR:cvf00536]  Heparan sulfate / Heparin   Chemokines    104288316 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  104288316 NCBI-ProteinID:  XP_009885404 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MTGKAVAALLTLLLISVVGAKGEAVPRSAIELRCQCVSTHSKFIHPKFIQNVNLTPSGPH CKNVEVIATLRDGREVCLEPTAPWVKLIIKAILDKANAKPDTAS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgacgggcaaggctgtggctgctctcctgactcttctcctcatctcggtggttggagca aaaggtgaggccgtgccacgctcagccattgaactccggtgccagtgcgtaagcacccat tccaagttcatccatcccaagttcattcagaacgtgaacctcacccccagtggacctcac tgcaagaacgttgaagtcatagctaccctgagagacggcagagaggtgtgcctggagccc accgctccctgggtgaagctgatcatcaaggcgattctggataaggcaaatgccaaacct gacacagcgtcctaa

DBGET integrated database retrieval system