Charadrius vociferus (killdeer): 104290389 Help Entry 104290389         CDS       T08577                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism cvf  Charadrius vociferus (killdeer) Pathway cvf04020   Calcium signaling pathway cvf04070   Phosphatidylinositol signaling system cvf04114   Oocyte meiosis cvf04218   Cellular senescence cvf04261   Adrenergic signaling in cardiomyocytes cvf04270   Vascular smooth muscle contraction cvf04371   Apelin signaling pathway cvf04625   C-type lectin receptor signaling pathway cvf04744   Phototransduction cvf04910   Insulin signaling pathway cvf04912   GnRH signaling pathway cvf04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cvf00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     104290389    04020 Calcium signaling pathway     104290389    04070 Phosphatidylinositol signaling system     104290389  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104290389    04218 Cellular senescence     104290389  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104290389   09152 Endocrine system    04910 Insulin signaling pathway     104290389    04912 GnRH signaling pathway     104290389    04916 Melanogenesis     104290389   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     104290389    04270 Vascular smooth muscle contraction     104290389   09157 Sensory system    04744 Phototransduction     104290389  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cvf01009]     104290389   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cvf04131]     104290389    03036 Chromosome and associated proteins [BR:cvf03036]     104290389   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cvf04147]     104290389 Protein phosphatases and associated proteins [BR:cvf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104290389 Membrane trafficking [BR:cvf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104290389 Chromosome and associated proteins [BR:cvf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104290389 Exosome [BR:cvf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104290389 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C EF-hand_11 EFhand_Ca_insen SPARC_Ca_bdg Dockerin_1 DUF1103 DUF5580_M FCaBP_EF-hand Poly_export SPEF2_C Motif Other DBs NCBI-GeneID:  104290389 NCBI-ProteinID:  XP_009887785 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKD GNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFLGLSDDELEEDELP TEQEEAALEVFEQRIAHAP NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgcgctcgctgggccagaaccccaccgaggccgagctgcaggacatgatcaacgaggtg gacgccgatggcaacggcaccattgacttccccgagttcctcaccatgatggcgaggaag atgaaggacacggacagcgaggaggagatccgagaggctttccgcgtcttcgacaaggac ggcaacgggtacatcagcgcggcggagctgcggcacgtgatgaccaacctcggggagaag ctgacggacgaggaggtggacgagatgatccgagaggccgacatcgacggtgacggacag gtcaactacgaggagttcctggggctctctgacgacgagctggaggaggacgagctcccc acggaacaagaagaggccgcgttggaggtctttgagcagcggattgctcacgccccgtag

DBGET integrated database retrieval system