Charadrius vociferus (killdeer): 104290704 Help Entry 104290704         CDS       T08577                                  Symbol CLDN19 Name (RefSeq) claudin-19   KO K06087   claudin Organism cvf  Charadrius vociferus (killdeer) Pathway cvf03272   Virion - Hepatitis viruses cvf04382   Cornified envelope formation cvf04514   Cell adhesion molecules cvf04530   Tight junction Brite KEGG Orthology (KO) [BR:cvf00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104290704 (CLDN19)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     104290704 (CLDN19)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104290704 (CLDN19)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104290704 (CLDN19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cvf03037]     104290704 (CLDN19)    04147 Exosome [BR:cvf04147]     104290704 (CLDN19)    04515 Cell adhesion molecules [BR:cvf04515]     104290704 (CLDN19) Cilium and associated proteins [BR:cvf03037]  Other cilia and associated proteins   Stereociliary proteins    104290704 (CLDN19) Exosome [BR:cvf04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104290704 (CLDN19)   Exosomal proteins of colorectal cancer cells    104290704 (CLDN19) Cell adhesion molecules [BR:cvf04515]  Immunoglobulin superfamily   L1 family    104290704 (CLDN19) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 CD20 SK_channel Motif Other DBs NCBI-GeneID:  104290704 NCBI-ProteinID:  XP_009888145 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MPGFPRGEARVRPGGVGVHIQTSRALMVISLLLGFFGIIVSVVGMKCTKVGEDDPVTKSR IAVAGGVLFVLSGLCTLAAVSLYATQVTYEFFRESTVPINARYEFGSALFIGSPGAGGEA FKCQRANCLCLLVPRLDHY NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgcccggattcccccgcggagaggcgagggtcaggcctggtggcgtgggggttcacatc cagacctcacgggctctcatggtgatttctcttctcctgggctttttcggcatcattgtg agcgtggtgggcatgaaatgcaccaaagttggtgaagacgatcctgtgaccaagagccgc atcgctgttgctggtggtgtcctcttcgtcctctccggtctgtgcacgttggccgccgtg tccttgtatgcaacccaggtgacctacgagttcttcagagagagcactgtccccatcaac gccaggtacgaattcggctcagctctcttcatcggatcccctggagcgggtggtgaagcc ttcaaatgccaacgtgctaattgcctctgcctccttgtacctcggctggaccactactaa

DBGET integrated database retrieval system