Charadrius vociferus (killdeer): 104291693 Help Entry 104291693         CDS       T08577                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism cvf  Charadrius vociferus (killdeer) Pathway cvf04010   MAPK signaling pathway cvf04137   Mitophagy - animal cvf04140   Autophagy - animal cvf04218   Cellular senescence cvf04371   Apelin signaling pathway cvf04625   C-type lectin receptor signaling pathway cvf04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:cvf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104291693 (RRAS2)    04371 Apelin signaling pathway     104291693 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104291693 (RRAS2)    04137 Mitophagy - animal     104291693 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     104291693 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104291693 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104291693 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cvf04147]     104291693 (RRAS2)    04031 GTP-binding proteins [BR:cvf04031]     104291693 (RRAS2) Exosome [BR:cvf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104291693 (RRAS2)   Exosomal proteins of bladder cancer cells    104291693 (RRAS2) GTP-binding proteins [BR:cvf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104291693 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU NPHI_C MMR_HSR1_Xtn FeThRed_B Motif Other DBs NCBI-GeneID:  104291693 NCBI-ProteinID:  XP_009889261 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLDHQRQV TQEEGQQLARQLKVTYMEASAKIRLNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKK GCHCVIF NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaacagtacatgaggacaggggagggttttctgcttgttttctcagtcactgat agaggaagttttgaagaaatctataagtttcagcgacaaattcttagagtgaaagatcgc gatgagtttcctatgattctagtcggtaataaagcagatctggaccaccaaagacaggtg acacaagaggaaggtcagcagctagcacggcaactgaaagtaacatacatggaagcctct gcaaaaatcagattgaatgtagaccaagcttttcacgaacttgtcagagttataaggaaa tttcaagaacaagagtgccctccttcaccagagccaacacggaaagaaaaagacaagaaa ggctgccattgtgttattttctga

DBGET integrated database retrieval system