Charadrius vociferus (killdeer): 104295590 Help Entry 104295590         CDS       T08577                                  Symbol TAC1 Name (RefSeq) protachykinin-1   KO K05239   tachykinin 1 Organism cvf  Charadrius vociferus (killdeer) Pathway cvf04080   Neuroactive ligand-receptor interaction cvf04082   Neuroactive ligand signaling Brite KEGG Orthology (KO) [BR:cvf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     104295590 (TAC1)    04082 Neuroactive ligand signaling     104295590 (TAC1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cvf04052]     104295590 (TAC1) Cytokines and neuropeptides [BR:cvf04052]  Neuropeptides   GPCR binding    104295590 (TAC1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tachykinin Motif Other DBs NCBI-GeneID:  104295590 NCBI-ProteinID:  XP_009893662 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MCEGMCVYLQTRVSPCVCGDLYLREELPLPLEHFLQRMARRPRPQQFFGLMGKRDAGYGQ ISHKRSSERSIAQNYERRRK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtgcgaagggatgtgtgtgtacctccagacacgtgtgtctccgtgtgtgtgtggagat ctgtatctccgcgaggagctgccgctgcccctggagcattttctgcagaggatggcccgg agaccccggccccagcagttcttcggcctcatgggcaagcgggatgccggatatggccag atctctcacaaaaggtcctctgaaaggagcatagcacagaattacgaacggaggcgtaaa tga

DBGET integrated database retrieval system