Chromobacterium violaceum: CV_2615 Help Entry CV_2615           CDS       T00147                                  Symbol iacP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cvi  Chromobacterium violaceum Pathway cvi01100   Metabolic pathways cvi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cvi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CV_2615 (iacP)    00074 Mycolic acid biosynthesis     CV_2615 (iacP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CV_2615 (iacP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAQ60285 LNCC_Brazil:  CV2615 UniProt:  Q7NUT2 LinkDB All DBs Position complement(2822032..2822262) Genome browser AA seq 76 aa AA seqDB search MVREVMAYSLSADAGRLQPQARLVDDLYADSLELLDMLMALNDAFGIELGVDDIAGIRTV ADVCAAVRRRLEAGMC NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggtcagggaggtgatggcgtacagcctttccgccgatgccgggcgcttgcagcctcag gccaggctggtggacgatttgtacgccgactcgctggagctgctggacatgctgatggcc ttgaatgacgcgttcggcatcgagctgggcgtcgacgacatcgcgggcatacgcacggtg gccgatgtctgcgcggcggttcgacgccgcctggaagccggaatgtgttga

DBGET integrated database retrieval system