Chromobacterium violaceum: CV_3639 Help Entry CV_3639           CDS       T00147                                  Symbol priB Name (GenBank) primosomal replication protein   KO K02686   primosomal replication protein N Organism cvi  Chromobacterium violaceum Pathway cvi03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cvi00001]  09120 Genetic Information Processing   09124 Replication and repair    03440 Homologous recombination     CV_3639 (priB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cvi03400]     CV_3639 (priB) DNA repair and recombination proteins [BR:cvi03400]  Prokaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     RecBC pathway proteins      CV_3639 (priB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB_1 SSB Motif Other DBs NCBI-ProteinID:  AAQ61301 LNCC_Brazil:  CV3639 UniProt:  Q7NRY8 LinkDB All DBs Position complement(3938359..3938658) Genome browser AA seq 99 aa AA seqDB search MQNRLVLTVTVDREDALRYTPAGLPVVEMWLKHQSRQSAGGFERDVACDIQAVWVGEEAK KHAGKLAGRVMNVTGFLSQRSLRNPRLVLNIEYVEFVKG NT seq 300 nt NT seq  +upstreamnt  +downstreamnt ttgcagaaccgcctggtactgaccgtcacggttgatcgcgaagatgcgctgagatacacg cccgccggcttgccggtcgtggaaatgtggctcaagcaccagtcccggcaaagcgccggg ggattcgaacgcgatgtggcctgcgacatacaggccgtgtgggtgggagaggaagccaaa aagcacgccgggaaactggcgggtcgggtgatgaacgtcaccggttttctcagccaacgc agcctgcgcaatccgcggttggtactcaatatcgaatacgttgaatttgtaaaaggttag

DBGET integrated database retrieval system