Calliphora vicina (urban bluebottle blowfly): 135959982
Help
Entry
135959982 CDS
T10781
Symbol
Rpn8
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
cvj Calliphora vicina (urban bluebottle blowfly)
Pathway
cvj03050
Proteasome
Brite
KEGG Orthology (KO) [BR:
cvj00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
135959982 (Rpn8)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
cvj03051
]
135959982 (Rpn8)
Proteasome [BR:
cvj03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
135959982 (Rpn8)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Tra1_central
SLC52_ribofla_tr
CobT
Motif
Other DBs
NCBI-GeneID:
135959982
NCBI-ProteinID:
XP_065367220
LinkDB
All DBs
Position
5:complement(86015739..86017469)
Genome browser
AA seq
337 aa
AA seq
DB search
MPSSEVLVNKVIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDISNSFAVP
FDEDDKDKSVWFLDHDYLENMYGMFKKVNAKERVVGWYHTGPKLHQNDIAINELIRRYCP
NSVLVIIDAKPKDLGLPTEAYIAVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLR
DIKDTTVGSLSQKITNQLMGLRGLKDQLDDIKSYLQRVGDGKMPINYQIVYQLQDIFNLL
PDLTNDQFTETMYVKTNDQMLVVYLASMVRSIIALHNLINNKLANRDAEEGKDKKTDDKT
KESKEKENKDTKDKKGGSDSEKTDKSKDDTNSKSSKK
NT seq
1014 nt
NT seq
+upstream
nt +downstream
nt
atgccgtcatcagaagttttggtaaacaaagtaatagttcatccattggttttgttgtcc
gtggtggatcacttcaatcgtatggggaagattggcaatcaaaaacgtgttgttggcgtt
ttattaggatgctggaggtctaaaggtgtcttggatatatccaacagttttgctgtgcct
ttcgatgaggatgataaagataaatctgtatggtttttggatcatgattatttggaaaat
atgtatggcatgtttaaaaaagtaaatgccaaagaacgtgttgtgggctggtaccacact
ggacccaaattgcatcaaaatgatattgccattaatgagttgataaggcgctattgtcca
aattctgtattagtcattatagatgccaaacctaaagatttaggtttacccacagaagcc
tatatagccgtagaggaagttcacgatgatggttcaccaaccagcaaaacttttgagcat
gttcccagtgaaattggcgcagaagaagccgaagaagtcggtgtggagcatttattgcgt
gacattaaggatacaactgtaggcagtttatcgcaaaagattaccaaccaattaatgggt
ctacgaggtctcaaggatcagttggatgatataaaaagttatttgcaacgagttggtgat
ggcaagatgcccataaattaccaaattgtttatcaactacaggatattttcaatcttctg
cccgacttaacaaacgatcaattcaccgagaccatgtatgtcaaaacaaatgatcaaatg
ttggtagtctatttagcctccatggttcgttctattatcgcccttcacaatctcatcaac
aacaaactggccaatcgtgatgctgaagaaggaaaggataagaaaaccgatgacaagacg
aaagagagcaaagaaaaggaaaacaaggatactaaggacaaaaagggaggttccgattcg
gaaaagaccgacaagagtaaggatgatacaaattccaagagcagtaagaaatag
DBGET
integrated database retrieval system