Crassostrea virginica (eastern oyster): 111102916 Help Entry 111102916         CDS       T09197                                  Name (RefSeq) C-Myc-binding protein-like   KO K25550   c-Myc-binding protein Organism cvn  Crassostrea virginica (eastern oyster) Brite KEGG Orthology (KO) [BR:cvn00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cvn03037]     111102916 Cilium and associated proteins [BR:cvn03037]  Motile cilia and associated proteins   Sperm associated proteins    111102916 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB TSC22 Cnn_1N bZIP_1 UPF0242 Seryl_tRNA_N DivIC HALZ ATG14 LPP V_ATPase_I Sas-6_C_CC Prominin DUF6549 bZIP_2 FapA HAP1_N Mto2_bdg YabA eIF-4B Shugoshin_N INO80F DUF6262 Herpes_BLRF2 Motif Other DBs NCBI-GeneID:  111102916 NCBI-ProteinID:  XP_022291570 UniProt:  A0A8B8AK64 LinkDB All DBs Position 7:14759241..14767496 Genome browser AA seq 98 aa AA seqDB search MTTYRGADSKREEFRRYLEKAGVLDALTKVLVGLYEEPEKPNNALDFLKQHLGASGPETA DTEALKLEVSELRQKVEQLTEENQELKAKLQQLDEETA NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacaacatacaggggagcagattctaagagggaggagttcagaagataccttgaaaaa gctggtgttctggatgctcttacaaaagttttggttggtctgtatgaagaaccagaaaaa ccaaacaatgctttggactttctaaagcagcacttgggtgcctcgggaccggagactgca gatacagaggctttaaagctagaagtttctgaacttagacagaaagtggaacaactaaca gaagaaaaccaagagctgaaagcaaagttacaacaactagatgaagagactgcttag

DBGET integrated database retrieval system