Crassostrea virginica (eastern oyster): 111129656 Help Entry 111129656         CDS       T09197                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism cvn  Crassostrea virginica (eastern oyster) Pathway cvn03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:cvn00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     111129656  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cvn03036]     111129656   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cvn04147]     111129656 Chromosome and associated proteins [BR:cvn03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111129656 Exosome [BR:cvn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111129656 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  111129656 NCBI-ProteinID:  XP_022331825 UniProt:  A0A8B8DVB3 LinkDB All DBs Position 4:39441750..39444128 Genome browser AA seq 100 aa AA seqDB search MRAVVRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLA IRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTQKPASK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgagagctgtcgtccgtctgctgaggaagggcaactacgccgagagagtgggagccggc gcccccgtgtacctggccgccgttctggagtatctggccgccgaagtgttggagttggca ggcaacgccgcccgtgacaacaagaagagcagaatcatcccccgtcacctgcagctggcc atccgcaacgacgaagagttgaacaaacttctgtccggtgtcaccattgcccagggtggt gtgctgcccaacatccaggccgtcctcctccccaagaagacccagaagccagccagcaag tag

DBGET integrated database retrieval system