Crassostrea virginica (eastern oyster): 111130430 Help Entry 111130430         CDS       T09197                                  Name (RefSeq) cdc42 homolog   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cvn  Crassostrea virginica (eastern oyster) Pathway cvn04145   Phagosome cvn04148   Efferocytosis cvn04310   Wnt signaling pathway cvn04620   Toll-like receptor signaling pathway cvn05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cvn00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     111130430  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111130430    04148 Efferocytosis     111130430  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111130430  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111130430  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cvn04131]     111130430   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cvn04147]     111130430    04031 GTP-binding proteins [BR:cvn04031]     111130430 Membrane trafficking [BR:cvn04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111130430  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111130430   Macropinocytosis    Ras GTPases     111130430  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111130430 Exosome [BR:cvn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111130430   Exosomal proteins of other body fluids (saliva and urine)    111130430   Exosomal proteins of colorectal cancer cells    111130430   Exosomal proteins of bladder cancer cells    111130430 GTP-binding proteins [BR:cvn04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111130430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  111130430 NCBI-ProteinID:  XP_022333210 UniProt:  A0A8B8DZ23 LinkDB All DBs Position 4:17327878..17328945 Genome browser AA seq 184 aa AA seqDB search MVVSVNKSLQCSILGDGFVGKSCLVERFLGGEFNQEYVATLQDNYTTTCKVNGDSLEMTI TDMAGEHVELGSLDVPDVFIVCFSLVDRDSLESVLNFWIPKIQSQGKDTPIVLIGTQLDK RRSQRKGHVATEEGLSIAQTMCASAYVECSAKENIGVDVALYSILLASNMCRRKSGLFKR VLGR NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atggtggtttctgtgaacaaatccctgcagtgttcgatcctaggggacggatttgtgggc aagtcttgtctggtggagcgatttctgggtggggagtttaaccaggagtatgtggcgaca ctccaggataactacaccacgacgtgcaaagtcaatggtgacagtctggagatgactatc acggatatggctggagagcacgtggaacttggctccctggatgtgcctgacgtatttatc gtctgttttagcctcgtggaccgggactccctagagagcgtcctcaacttctggataccc aaaatacagtcccaggggaaagacacgcccatcgtcctgatcggaactcagctcgacaaa cgacgatctcaaagaaagggccatgtcgctacagaggaagggctcagcattgcacaaacc atgtgtgcctccgcctatgttgaatgttccgcaaaggagaacatcggagtggatgttgct ctgtatagcatcctactggccagcaacatgtgccggaggaagtccggcctgttcaagaga gtgctcggtagatga

DBGET integrated database retrieval system