Chlorella variabilis: CHLNCDRAFT_136080 Help Entry CHLNCDRAFT_136080 CDS       T02924                                  Name (RefSeq) expressed protein   KO K09481   protein transport protein SEC61 subunit beta Organism cvr  Chlorella variabilis Pathway cvr03060   Protein export cvr04141   Protein processing in endoplasmic reticulum cvr04145   Phagosome Brite KEGG Orthology (KO) [BR:cvr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CHLNCDRAFT_136080    04141 Protein processing in endoplasmic reticulum     CHLNCDRAFT_136080  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CHLNCDRAFT_136080  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cvr04131]     CHLNCDRAFT_136080   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cvr02044]     CHLNCDRAFT_136080 Membrane trafficking [BR:cvr04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     CHLNCDRAFT_136080 Secretion system [BR:cvr02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    CHLNCDRAFT_136080 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta CLSTN_C Motif Other DBs NCBI-GeneID:  17353434 NCBI-ProteinID:  XP_005846006 JGI:  ChlNC64A_1_136080 UniProt:  E1ZJQ1 LinkDB All DBs Position Unknown AA seq 68 aa AA seqDB search MAGPLAKRSDGAVSRRRSSAAGRGKSGSSYFYTDASSVLKLSPQAVIVAAISFIVFVFVL HIFGKLRS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggcaggccccttggccaagcgctccgatggcgcggtgtctcggcggcgaagctcagcg gcagggcgcggcaagtcgggctctagctacttttacacagacgcctcctcggtcctcaag ctctcgccgcaagcggtgattgtggcagctattagctttatcgtgtttgtctttgtcctg catatcttcggcaagctgcgcagctga

DBGET integrated database retrieval system