Chlorella variabilis: CHLNCDRAFT_143775 Help Entry CHLNCDRAFT_143775 CDS       T02924                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism cvr  Chlorella variabilis Pathway cvr03022   Basal transcription factors cvr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cvr00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     CHLNCDRAFT_143775   09124 Replication and repair    03420 Nucleotide excision repair     CHLNCDRAFT_143775  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cvr03021]     CHLNCDRAFT_143775    03400 DNA repair and recombination proteins [BR:cvr03400]     CHLNCDRAFT_143775 Transcription machinery [BR:cvr03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      CHLNCDRAFT_143775 DNA repair and recombination proteins [BR:cvr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      CHLNCDRAFT_143775 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  17356355 NCBI-ProteinID:  XP_005849151 JGI:  ChlNC64A_1_143775 UniProt:  E1ZAE8 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MVQATHGVLITGDVVLIEFIRSLNEEQPPKERFIIKDLGEKNLFIKDKKVEFVQKKVAEW QQSLRFEPKKDQQQQQQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggtgcaagctacccacggagtcttgatcaccggagacgttgtactgatcgagttcatc cgctcgctcaacgaggagcagccacccaaggaaaggttcatcatcaaagacctgggcgaa aagaatttgttcatcaaggacaagaaggttgagtttgtgcagaagaaggtggctgagtgg cagcagagcctgcggttcgagcccaagaaggaccagcagcagcagcagcagcagtga

DBGET integrated database retrieval system