Chlorella variabilis: CHLNCDRAFT_15005 Help Entry CHLNCDRAFT_15005  CDS       T02924                                  Name (RefSeq) hypothetical protein   KO K12668   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit DAD1/OST2 Organism cvr  Chlorella variabilis Pathway cvr00510   N-Glycan biosynthesis cvr00513   Various types of N-glycan biosynthesis cvr01100   Metabolic pathways cvr04141   Protein processing in endoplasmic reticulum Module cvr_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:cvr00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     CHLNCDRAFT_15005    00513 Various types of N-glycan biosynthesis     CHLNCDRAFT_15005  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     CHLNCDRAFT_15005 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DAD Motif Other DBs NCBI-GeneID:  17351156 NCBI-ProteinID:  XP_005843779 JGI:  ChlNC64A_1_15005 UniProt:  E1ZR64 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search KDIYTSFTAAYIKTPTKLKLLDAFSCCALATALLQFVYAKAVGTFPFNAFLAGFFCCVGS FVLTLSLRMKVSE NT seq 219 nt NT seq  +upstreamnt  +downstreamnt aaggatatctacacctcgtttacggctgcctacatcaagacgcccacgaaactgaagctg ttggacgccttcagctgctgcgcactggcgaccgccctgctgcaatttgtgtatgccaag gcggtgggcaccttccccttcaacgccttcctggccggcttcttctgctgcgtgggctcg tttgtgctcacgctcagcctgcgcatgaaggtcagcgag

DBGET integrated database retrieval system