Chlorella variabilis: CHLNCDRAFT_19308 Help Entry CHLNCDRAFT_19308  CDS       T02924                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism cvr  Chlorella variabilis Pathway cvr03020   RNA polymerase cvr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cvr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CHLNCDRAFT_19308   09124 Replication and repair    03420 Nucleotide excision repair     CHLNCDRAFT_19308  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cvr03021]     CHLNCDRAFT_19308    03400 DNA repair and recombination proteins [BR:cvr03400]     CHLNCDRAFT_19308 Transcription machinery [BR:cvr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CHLNCDRAFT_19308   RNA polymerase III system    RNA polymerase III      CHLNCDRAFT_19308   RNA polymerase I system    RNA polymerase I      CHLNCDRAFT_19308 DNA repair and recombination proteins [BR:cvr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CHLNCDRAFT_19308 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_RPAB4 Zn_Ribbon_YjdM DUF7577 DUF6237 Zn_ribbon_13 DZR DUF5816 Zn_ribbon_3 DUF6510 HypA DUF6083 Motif Other DBs NCBI-GeneID:  17358590 NCBI-ProteinID:  XP_005851333 JGI:  ChlNC64A_1_19308 UniProt:  E1Z3T6 LinkDB All DBs Position Unknown AA seq 62 aa AA seqDB search MQGTAGYGAPAPTGPVQVAYICGDCGAENTLKPGDVIRCRECGYRILYKKRTKRVVQYEA RW NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgcagggcacggcaggctatggcgcaccagcgcccacgggacccgtgcaggtggcctac atttgcggcgactgcggcgcggagaacacgctcaagccgggggacgtcattcgctgccgc gagtgcgggtacagaatactgtacaagaagcggaccaagcgcgtggtgcagtatgaggcg cgatggtga

DBGET integrated database retrieval system