Chlorella variabilis: CHLNCDRAFT_19532 Help Entry CHLNCDRAFT_19532  CDS       T02924                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism cvr  Chlorella variabilis Pathway cvr03020   RNA polymerase cvr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cvr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CHLNCDRAFT_19532   09124 Replication and repair    03420 Nucleotide excision repair     CHLNCDRAFT_19532  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cvr03021]     CHLNCDRAFT_19532    03400 DNA repair and recombination proteins [BR:cvr03400]     CHLNCDRAFT_19532 Transcription machinery [BR:cvr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CHLNCDRAFT_19532   RNA polymerase III system    RNA polymerase III      CHLNCDRAFT_19532   RNA polymerase I system    RNA polymerase I      CHLNCDRAFT_19532 DNA repair and recombination proteins [BR:cvr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CHLNCDRAFT_19532 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  17358083 NCBI-ProteinID:  XP_005850792 JGI:  ChlNC64A_1_19532 UniProt:  E1Z6Q4 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search RCFTCGKVIGNKWETYLDLLQAEYSEGDAMDALGLNRYCCRRMVMTHVDLIEKLLNYNTL ERQPAQGQQQQHNLS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt aggtgctttacatgtggtaaagtgatcggaaacaagtgggagacatacctagacttgctg caggcggagtattcagaaggggatgcaatggacgcgctgggcttgaaccgctactgctgt cgacgaatggtcatgacgcacgtggatctgattgagaagctgcttaactacaatacactg gagcggcagccagcgcagggccagcagcagcagcacaacctgagctga

DBGET integrated database retrieval system