Citrobacter werkmanii: CO701_23380 Help Entry CO701_23380       CDS       T05129                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cwe  Citrobacter werkmanii Pathway cwe01100   Metabolic pathways cwe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cwe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CO701_23380    00074 Mycolic acid biosynthesis     CO701_23380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CO701_23380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ATF51836 LinkDB All DBs Position complement(4739126..4739383) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIITTLNLDELTADDIETDAALFGDGLGLDSIDALELGLAVKNEYGVVLS AESEEMRQHFFSVATLASFIHAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatcttgaaatcaaaaatctcattataacgacattgaatctcgacgaa cttactgctgacgatattgaaaccgacgcagcgctgtttggcgatggcttagggctggac tccatcgacgccctggagttaggcctggcggtgaaaaatgagtatggcgtggttctctcg gctgagagcgaagagatgcgccagcacttcttctccgtcgccacgctggcatctttcatt cacgcgcaacgtgcctga

DBGET integrated database retrieval system